BYKdb

Annotate results for A0A1C6B4L6

A0A1C6B4L6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C6B4L6
DOMAINtad3/158NSYTIKELIGLFLNKIWIIIIVTIAGGILSFGFSKMFLPFEYSSHVSMYVQSYTGISDQM
ADQNNISNSKQLVNTYMEVLKDDAVMAAIGELLLEQFDEVILSENFTFNMSGEIETESLR
KCIELSTVTDTSAVKVIATAKNPEIAASICNNLTSI
DOMAINcd290/478SSANPSEGKSIISANIAIALAQGGNKALLIDADMRKAVQHKIFEIKNKKGLSTAISKMNK
LDECIQKNVMENLDVMTSGPLPPNPSELLASENMLAILDELNKKYQIIIIDTPPVNVVTD
AMELAKCVSGIVVVLCYGRTTTEDIEAVVKKMEFSKVNMLGFILNSIKNKRSGRYYSKYK
YDYKRGYGY
SITEWalker A297/299GKS
SITEWalker A'317/324LLIDADMR
SITEWalker B397/403IIIDTPP
SITEY Cluster464/479YYSKYKYDYKRGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MENSYTIKELIGLFLNKIWIIIIVTIAGGILSFGFSKMFLPFEYSSHVSMYVQSYTGISDQMADQNNISNSKQLVNTYME
  NSYTIKELIGLFLNKIWIIIIVTIAGGILSFGFSKMFLPFEYSSHVSMYVQSYTGISDQMADQNNISNSKQLVNTYME

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLKDDAVMAAIGELLLEQFDEVILSENFTFNMSGEIETESLRKCIELSTVTDTSAVKVIATAKNPEIAASICNNLTSIAP
VLKDDAVMAAIGELLLEQFDEVILSENFTFNMSGEIETESLRKCIELSTVTDTSAVKVIATAKNPEIAASICNNLTSI  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYVAKAVGVGSINTIDKAKVYETPVAPNVIKNTLLGMAAALLIVVTIILITDYFDNTVKDVALLEKKYKKAIIGEIQEFA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AERNDKSSKDNYSKLTDKDIPFYIVERYKSIRTNVNFSLATSDKKIFAVSSANPSEGKSIISANIAIALAQGGNKALLID
                                                 SSANPSEGKSIISANIAIALAQGGNKALLID
                                                        GKS                 LLID
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADMRKAVQHKIFEIKNKKGLSTAISKMNKLDECIQKNVMENLDVMTSGPLPPNPSELLASENMLAILDELNKKYQIIIID
ADMRKAVQHKIFEIKNKKGLSTAISKMNKLDECIQKNVMENLDVMTSGPLPPNPSELLASENMLAILDELNKKYQIIIID
ADMR                                                                        IIID
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPPVNVVTDAMELAKCVSGIVVVLCYGRTTTEDIEAVVKKMEFSKVNMLGFILNSIKNKRSGRYYSKYKYDYKRGYGYYG
TPPVNVVTDAMELAKCVSGIVVVLCYGRTTTEDIEAVVKKMEFSKVNMLGFILNSIKNKRSGRYYSKYKYDYKRGYGY  
TPP                                                            YYSKYKYDYKRGYGYY 
       490   
....:....|...
EKTDKNETKNEKK


© 1998-2019