BYKdb

Annotate results for A0A1C6CX13

A0A1C6CX13 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6CX13
DOMAINcd39/226TSTQQNEGKSTVASNLAISFSKLPNKKILLIDADLRNPSIHRVFSIGNSDGMMSILKGDK
DLKSTVYNLNENLDILTTGVIPPNPDEILVTDKMKEFIQQIKEKYDYIFIDSPPIGIVSD
ASLLSQLSDGVIFVISSGEVETDFAKLAKEKLMNVDAKILGAVLNKYESHNDDYGYYYSE
YYGARKKR
SITEWalker A46/48GKS
SITEWalker A'67/74LLIDADLR
SITEWalker B146/152IFIDSPP
SITE-143/-145YDY
SITEY Cluster212/220YGYYYSEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
METIDKLDAKSPIVEAYRSVRTSIEYSNLDAKLKIILVTSTQQNEGKSTVASNLAISFSKLPNKKILLIDADLRNPSIHR
                                      TSTQQNEGKSTVASNLAISFSKLPNKKILLIDADLRNPSIHR
                                             GKS                  LLIDADLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VFSIGNSDGMMSILKGDKDLKSTVYNLNENLDILTTGVIPPNPDEILVTDKMKEFIQQIKEKYDYIFIDSPPIGIVSDAS
VFSIGNSDGMMSILKGDKDLKSTVYNLNENLDILTTGVIPPNPDEILVTDKMKEFIQQIKEKYDYIFIDSPPIGIVSDAS
                                                                 IFIDSPP        
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLSQLSDGVIFVISSGEVETDFAKLAKEKLMNVDAKILGAVLNKYESHNDDYGYYYSEYYGARKKRKLFRLGKFKRKTKK
LLSQLSDGVIFVISSGEVETDFAKLAKEKLMNVDAKILGAVLNKYESHNDDYGYYYSEYYGARKKR              
                                                   YGYYYSEYY                    
       
....:..
HLKVEKA


© 1998-2019