BYKdb

Annotate results for A0A1C6D7M5

A0A1C6D7M5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6D7M5
DOMAINcd52/238TSSVRGEGKSTIAINLAYALAEDGKTVLLIDGDLRLPSIAKKLGYKNQPGLTDFLQGGDT
KVYKTNIHENWYVMMSGNIPPNPSELLGSAKMEKMLHMMADRFDYIIIDLPPVNVVTDAL
AISKLISGMILVVREEYVEKRELDNCVRQLKLSNVNVLGCVMNNAKDEKAAYGKYSKYGK
YKTYYYQ
SITE-75/-77GKT
SITEWalker A'79/86LLIDGDLR
SITEWalker B157/163IIIDLPP
SITEY Cluster223/237YGKYSKYGKYKTYYY
SITEWalker A59/61GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKTKKHQLAVTDKKTLHQNLSFVAKEQYKMLRTNLNFVLPDDLKCPIIGVTSSVRGEGKSTIAINLAYALAEDGKTVLL
                                                   TSSVRGEGKSTIAINLAYALAEDGKTVLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDGDLRLPSIAKKLGYKNQPGLTDFLQGGDTKVYKTNIHENWYVMMSGNIPPNPSELLGSAKMEKMLHMMADRFDYIIID
IDGDLRLPSIAKKLGYKNQPGLTDFLQGGDTKVYKTNIHENWYVMMSGNIPPNPSELLGSAKMEKMLHMMADRFDYIIID
IDGDLR                                                                      IIID
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPPVNVVTDALAISKLISGMILVVREEYVEKRELDNCVRQLKLSNVNVLGCVMNNAKDEKAAYGKYSKYGKYKTYYYQQP
LPPVNVVTDALAISKLISGMILVVREEYVEKRELDNCVRQLKLSNVNVLGCVMNNAKDEKAAYGKYSKYGKYKTYYYQ  
LPP                                                           YGKYSKYGKYKTYYY   
       250    
....:....|....
ESEELPGAETVTES


© 1998-2019