BYKdb

Annotate results for A0A1C6EBS6

A0A1C6EBS6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6EBS6
DOMAINcd39/229TSCVPGEGKTRSAIELAYTFAELNKPVLLIDADMRKSVMVSRLQIQGVEQGLSHFLSGQC
SLADIVIETNVPKMHVMLAGPLVPNPTELLSTKRFRSMIESLRKVYEYIIIDSPPLGMVI
DAAIIAKNCDGAIMVVESAKTKYRLAQNVKEKLENAGCTVMGVVLNKVDRKKQGGYYNKY
YGASYGKKGYG
SITEWalker A46/48GKT
SITEWalker A'66/73LLIDADMR
SITEWalker B147/153IIIDSPP
SITE-144/-146YEY
SITEY Cluster214/234YYNKYYGASYGKKGYGEYYRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKAKIEIRQMAYATREALKTLRTNVQFCGDDKRVILVTSCVPGEGKTRSAIELAYTFAELNKPVLLIDADMRKSVMVSR
                                      TSCVPGEGKTRSAIELAYTFAELNKPVLLIDADMRKSVMVSR
                                             GKT                 LLIDADMR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQIQGVEQGLSHFLSGQCSLADIVIETNVPKMHVMLAGPLVPNPTELLSTKRFRSMIESLRKVYEYIIIDSPPLGMVIDA
LQIQGVEQGLSHFLSGQCSLADIVIETNVPKMHVMLAGPLVPNPTELLSTKRFRSMIESLRKVYEYIIIDSPPLGMVIDA
                                                                  IIIDSPP       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIIAKNCDGAIMVVESAKTKYRLAQNVKEKLENAGCTVMGVVLNKVDRKKQGGYYNKYYGASYGKKGYGEYYRYEPEEKE
AIIAKNCDGAIMVVESAKTKYRLAQNVKEKLENAGCTVMGVVLNKVDRKKQGGYYNKYYGASYGKKGYG           
                                                     YYNKYYGASYGKKGYGEYYRY      
© 1998-2019