BYKdb

Annotate results for A0A1C6ERZ2

A0A1C6ERZ2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6ERZ2
DOMAINcd40/229TSSVPNEGKSSVSFDLSKTMAEGGKKILMVDADLRKSVLAAKYHIQGIDKGLSHYLTGQA
EIEDIIYETETEGFYLTVAGPLSPDPTSILDSEQFQKFIDKVRDDYDYVIIDAPPLGVVI
DAVIIGKYCDGAVLVIEQGVIKRKVVQDVIKQLKRGGVRILGAVLNKVDERIGAYGSYDY
KYSYSYYGHS
SITEWalker A47/49GKS
SITEWalker A'67/74LMVDADLR
SITEWalker B148/154VIIDAPP
SITE-145/-147YDY
SITEY Cluster214/226YGSYDYKYSYSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKVTMNLPEIKDYRLTEGLNQLKTNLAFCGKDIKVITMTSSVPNEGKSSVSFDLSKTMAEGGKKILMVDADLRKSVLAA
                                       TSSVPNEGKSSVSFDLSKTMAEGGKKILMVDADLRKSVLAA
                                              GKS                 LMVDADLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KYHIQGIDKGLSHYLTGQAEIEDIIYETETEGFYLTVAGPLSPDPTSILDSEQFQKFIDKVRDDYDYVIIDAPPLGVVID
KYHIQGIDKGLSHYLTGQAEIEDIIYETETEGFYLTVAGPLSPDPTSILDSEQFQKFIDKVRDDYDYVIIDAPPLGVVID
                                                                   VIIDAPP      
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
AVIIGKYCDGAVLVIEQGVIKRKVVQDVIKQLKRGGVRILGAVLNKVDERIGAYGSYDYKYSYSYYGHSDAEDKH
AVIIGKYCDGAVLVIEQGVIKRKVVQDVIKQLKRGGVRILGAVLNKVDERIGAYGSYDYKYSYSYYGHS      
                                                     YGSYDYKYSYSYY         
© 1998-2019