BYKdb

Annotate results for A0A1C6ESQ2

A0A1C6ESQ2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6ESQ2
DOMAINcd39/227TSSFSGEGKSTITYQLAKSLAELGKRVLLIDADMRKSVMVNMLESGSVDKGLSHYLSGQC
SLSEAVYATESSRLHILFAGPVPPNPTELLSGELFKDTLNSFRDIYDYIFIDCAPVGMVI
DAAIVAKCSDAAIMMIESGAVKRKLALEAKEKLETAGCPILGVVLNKVERKSGGYYRKYY
KKYEEAAKV
SITEWalker A46/48GKS
SITEWalker A'66/73LLIDADMR
SITEWalker B147/153IFIDCAP
SITE-144/-146YDY
SITEY Cluster213/221YYRKYYKKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKRVTLKKREMSYAMTEELNTLRTNIQFSGVDKKVIVMTSSFSGEGKSTITYQLAKSLAELGKRVLLIDADMRKSVMVNM
                                      TSSFSGEGKSTITYQLAKSLAELGKRVLLIDADMRKSVMVNM
                                             GKS                 LLIDADMR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LESGSVDKGLSHYLSGQCSLSEAVYATESSRLHILFAGPVPPNPTELLSGELFKDTLNSFRDIYDYIFIDCAPVGMVIDA
LESGSVDKGLSHYLSGQCSLSEAVYATESSRLHILFAGPVPPNPTELLSGELFKDTLNSFRDIYDYIFIDCAPVGMVIDA
                                                                  IFIDCAP       
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
AIVAKCSDAAIMMIESGAVKRKLALEAKEKLETAGCPILGVVLNKVERKSGGYYRKYYKKYEEAAKVEG
AIVAKCSDAAIMMIESGAVKRKLALEAKEKLETAGCPILGVVLNKVERKSGGYYRKYYKKYEEAAKV  
                                                    YYRKYYKKY        
© 1998-2019