BYKdb

Annotate results for A0A1C6FL55

A0A1C6FL55 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6FL55
DOMAINcd38/224TSSIMGEGKSTVAGNIANILSQDGARVLMIDCDLRKPSMHYNFFVTNGEGLTDLLVGNSD
LKSVMKKVDDSLFLITAGTVPPNPSEILGSHGMEKLLEELSVNFDYIVLDTPPVLPVTDA
LLLSAKADGTLIVVKSRVTKEKMVKETYDKLIDVRANVIGTVLNGCDKSIDNKYYGYYGD
FKKHKEK
SITEWalker A45/47GKS
SITEWalker A'65/72LMIDCDLR
SITEWalker B144/150IVLDTPP
SITEY Cluster211/215YYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFITKKMPKSLSAEAYRSLRTSIKFSSVDRPIKTLVVTSSIMGEGKSTVAGNIANILSQDGARVLMIDCDLRKPSMHYNF
                                     TSSIMGEGKSTVAGNIANILSQDGARVLMIDCDLRKPSMHYNF
                                            GKS                 LMIDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FVTNGEGLTDLLVGNSDLKSVMKKVDDSLFLITAGTVPPNPSEILGSHGMEKLLEELSVNFDYIVLDTPPVLPVTDALLL
FVTNGEGLTDLLVGNSDLKSVMKKVDDSLFLITAGTVPPNPSEILGSHGMEKLLEELSVNFDYIVLDTPPVLPVTDALLL
                                                               IVLDTPP          
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
SAKADGTLIVVKSRVTKEKMVKETYDKLIDVRANVIGTVLNGCDKSIDNKYYGYYGDFKKHKEKKFKIKRK
SAKADGTLIVVKSRVTKEKMVKETYDKLIDVRANVIGTVLNGCDKSIDNKYYGYYGDFKKHKEK       
                                                  YYGYY                
© 1998-2019