BYKdb

Annotate results for A0A1C6FMD7

A0A1C6FMD7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6FMD7
DOMAINcd38/221TSSLASEGKSTISGNLAYVLSENNNKVLLIDCDLRKPSLHKKFKVSNEKGITDLLVNKCT
INEVIKVMSKGVHLITAGTIPPNPAEIVGSKALKDFIDNMEEDYDYIVIDTPPVLAVTDA
QLLAAKCDGTVLVSRAKKSRTKYVKLAYNELEKVRANVIGSILNDSDMKQKYGYYKHYSS
DLKK
SITEWalker A45/47GKS
SITEWalker A'65/72LLIDCDLR
SITEWalker B144/150IVIDTPP
SITE-141/-143YDY
SITEY Cluster180/215YVKLAYNELEKVRANVIGSILNDSDMKQKYGYYKHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFIAQMMPRSISAEAYRSIRTSIQYSSIDKKIKTLVVTSSLASEGKSTISGNLAYVLSENNNKVLLIDCDLRKPSLHKKF
                                     TSSLASEGKSTISGNLAYVLSENNNKVLLIDCDLRKPSLHKKF
                                            GKS                 LLIDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVSNEKGITDLLVNKCTINEVIKVMSKGVHLITAGTIPPNPAEIVGSKALKDFIDNMEEDYDYIVIDTPPVLAVTDAQLL
KVSNEKGITDLLVNKCTINEVIKVMSKGVHLITAGTIPPNPAEIVGSKALKDFIDNMEEDYDYIVIDTPPVLAVTDAQLL
                                                               IVIDTPP          
       170       180       190       200       210       220 
....:....|....:....|....:....|....:....|....:....|....:....|.
AAKCDGTVLVSRAKKSRTKYVKLAYNELEKVRANVIGSILNDSDMKQKYGYYKHYSSDLKK
AAKCDGTVLVSRAKKSRTKYVKLAYNELEKVRANVIGSILNDSDMKQKYGYYKHYSSDLKK
                   YVKLAYNELEKVRANVIGSILNDSDMKQKYGYYKHY      
© 1998-2019