BYKdb

Annotate results for A0A1C6FQQ1

A0A1C6FQQ1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6FQQ1
DOMAINcd39/226TSSVPNEGKSTVSVRLWKLLSEAGFPTVLVDVDLRKSEIQKKYQVEGIKEGLNHFLSGLA
EYEDVVYETNIPNGHIVPVTTLLENPSALLEDPRLGELLDRLAEDYRYVIIDTPPLDNIS
DGALIASMSDGAVLVVRCGETSKALVRQSLQQLDRVGCPVLGTVLNRAEIRSGAYKKYYN
RYGKKYGD
SITEWalker A46/48GKS
SITEWalker A'66/73VLVDVDLR
SITEWalker B147/153VIIDTPP
SITE-100/-146YEDVVYETNIPNGHIVPVTTLLENPSALLEDPRLGELLDRLAEDYRY
SITEY Cluster213/232YKKYYNRYGKKYGDYYGAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKLNLKIKDMPYAAEEALNRLRVNIKFCGKNTKKIVITSSVPNEGKSTVSVRLWKLLSEAGFPTVLVDVDLRKSEIQKK
                                      TSSVPNEGKSTVSVRLWKLLSEAGFPTVLVDVDLRKSEIQKK
                                             GKS                 VLVDVDLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YQVEGIKEGLNHFLSGLAEYEDVVYETNIPNGHIVPVTTLLENPSALLEDPRLGELLDRLAEDYRYVIIDTPPLDNISDG
YQVEGIKEGLNHFLSGLAEYEDVVYETNIPNGHIVPVTTLLENPSALLEDPRLGELLDRLAEDYRYVIIDTPPLDNISDG
                                                                  VIIDTPP       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALIASMSDGAVLVVRCGETSKALVRQSLQQLDRVGCPVLGTVLNRAEIRSGAYKKYYNRYGKKYGDYYGAYYGGNTTEKK
ALIASMSDGAVLVVRCGETSKALVRQSLQQLDRVGCPVLGTVLNRAEIRSGAYKKYYNRYGKKYGD              
                                                    YKKYYNRYGKKYGDYYGAYY        
     
....:
AGIKE


© 1998-2019