BYKdb

Annotate results for A0A1C6G0U3

A0A1C6G0U3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C6G0U3
DOMAINtad3/141EKLDFIEVLKIINKRKIIVISILSIFIIVTAIFNFYIIEPTYVADTTIIVSKSVTNTNDT
ISSEELSVTKNLAITYANIIKSRAVLEKVINSMNLENSYEEVYSSINVQSIEDTQIIKIS
VQNKSPEIARDIANSIPEI
DOMAINcd266/440TSSQPGEGKSTFISNISKVFATLDDKKILLIDCDFRRPKIHKIFKISNTQGLTNILVKNI
HISECINTVSGLNIITSGTKPINPSDILASKKMINFIKQIRNEYDYIFIDSPPVNIVSDS
EVLSRIVDGVIVVIGCNEVDRNSVKQCKEKLNNLNANILGCIVNKENIKKGNYYY
SITEWalker A273/275GKS
SITEWalker A'294/301LLIDCDFR
SITEWalker B372/378IFIDSPP
SITE-369/-371YDY
SITEY Cluster438/440YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKEKLDFIEVLKIINKRKIIVISILSIFIIVTAIFNFYIIEPTYVADTTIIVSKSVTNTNDTISSEELSVTKNLAITYAN
  EKLDFIEVLKIINKRKIIVISILSIFIIVTAIFNFYIIEPTYVADTTIIVSKSVTNTNDTISSEELSVTKNLAITYAN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIKSRAVLEKVINSMNLENSYEEVYSSINVQSIEDTQIIKISVQNKSPEIARDIANSIPEIFKEEVKRLTNTNKVEIIDK
IIKSRAVLEKVINSMNLENSYEEVYSSINVQSIEDTQIIKISVQNKSPEIARDIANSIPEI                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIVNEKPIKPRKLINIAIASIIGILISIAFAFILDYLDSKIKNKGDVEKYLDLPIIGGIPMDKMLKKEVTNTLISNEGPI


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEAYRSIRTNIEFFNIDKTIKVIMVTSSQPGEGKSTFISNISKVFATLDDKKILLIDCDFRRPKIHKIFKISNTQGLTNI
                         TSSQPGEGKSTFISNISKVFATLDDKKILLIDCDFRRPKIHKIFKISNTQGLTNI
                                GKS                  LLIDCDFR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVKNIHISECINTVSGLNIITSGTKPINPSDILASKKMINFIKQIRNEYDYIFIDSPPVNIVSDSEVLSRIVDGVIVVIG
LVKNIHISECINTVSGLNIITSGTKPINPSDILASKKMINFIKQIRNEYDYIFIDSPPVNIVSDSEVLSRIVDGVIVVIG
                                                   IFIDSPP                      
       410       420       430       440
....:....|....:....|....:....|....:....|
CNEVDRNSVKQCKEKLNNLNANILGCIVNKENIKKGNYYY
CNEVDRNSVKQCKEKLNNLNANILGCIVNKENIKKGNYYY
                                     YYY
© 1998-2019