BYKdb

Annotate results for A0A1C6G8M0

A0A1C6G8M0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C6G8M0
DOMAINtad22/156DTIDLLEIFRALYRRWVWIVFTALVFGIALGMYGKFVVKDVFQAEASMCIIDSNKEVSIS
DLQIGSALTNDYEGIIKSRVVLTKVISNLNLDIAYKSLYNAVSVDNPEATRIIRIRVVSG
NKEEAVDIANEILSV
DOMAINcd282/471TSAFENQGKSFISFHLAYSLSQVGKRVLLVDTDMRKSVLQRRMGLEGVKLGLSEYLSGNA
EVGQVIYDVGIPNMHVLFSGKLVTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGVVG
DAAIVSSVCDGTLLVIENGVTKKKTLCQIAAELEKIDTNILGVVQNMVGSKKDSSYYGKG
NYGYYYGNNQ
SITEWalker A289/291GKS
SITEWalker A'309/316LLVDTDMR
SITEWalker B390/396IIFDTPP
SITE-387/-389YDY
SITEY Cluster457/467YYGKGNYGYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGGVCDFMENKKAVAVENAAEDTIDLLEIFRALYRRWVWIVFTALVFGIALGMYGKFVVKDVFQAEASMCIIDSNKEVSI
                     DTIDLLEIFRALYRRWVWIVFTALVFGIALGMYGKFVVKDVFQAEASMCIIDSNKEVSI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDLQIGSALTNDYEGIIKSRVVLTKVISNLNLDIAYKSLYNAVSVDNPEATRIIRIRVVSGNKEEAVDIANEILSVSIEE
SDLQIGSALTNDYEGIIKSRVVLTKVISNLNLDIAYKSLYNAVSVDNPEATRIIRIRVVSGNKEEAVDIANEILSV    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IPHVLGSNTPTVLDKADEFFAENTRRSVVSYILIGLMAGIVVSCGVIAISVITNTSIKNEEDIQKCSGLSVLGTIPDYKG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKKRKEKIIWPDELPFSAAEAIYQLRTAILYSSKDVKMIAVTSAFENQGKSFISFHLAYSLSQVGKRVLLVDTDMRKSVL
                                         TSAFENQGKSFISFHLAYSLSQVGKRVLLVDTDMRKSVL
                                                GKS                 LLVDTDMR    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRRMGLEGVKLGLSEYLSGNAEVGQVIYDVGIPNMHVLFSGKLVTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGVV
QRRMGLEGVKLGLSEYLSGNAEVGQVIYDVGIPNMHVLFSGKLVTNASALLSAKWLRTLCDSVKDSYDYIIFDTPPVGVV
                                                                     IIFDTPP    
       410       420       430       440       450       460       470    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
GDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAELEKIDTNILGVVQNMVGSKKDSSYYGKGNYGYYYGNNQNKK
GDAAIVSSVCDGTLLVIENGVTKKKTLCQIAAELEKIDTNILGVVQNMVGSKKDSSYYGKGNYGYYYGNNQ   
                                                        YYGKGNYGYYY       
© 1998-2019