BYKdb

Annotate results for A0A1C6GIN3

A0A1C6GIN3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6GIN3
DOMAINcd39/232TSCQPNEGKSTISSYLWKMLAEAGFPTVLVDVDLRKSVMKTRFQMDYDDDTTMGLNHYLS
GMAEYEDVVYSTNIPNGYMVPCTQLLENPSALLEDVRFKELLNTLSENYRFVIIDSPPLG
SVADGALIASLCDGAVLVVRAGTTPRTLIKQSLYEIQQSGCKLLGTVLNRADVKGRAYGK
YGYGKYGYGYGYGY
SITEWalker A46/48GKS
SITEWalker A'66/73VLVDVDLR
SITEWalker B150/156VIIDSPP
SITE-103/-108YEDVVY
SITEY Cluster216/236YGKYGYGKYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQLNVNLPELPYAVSEAMNRLRINIKFCGKNTRKILLTSCQPNEGKSTISSYLWKMLAEAGFPTVLVDVDLRKSVMKTR
                                      TSCQPNEGKSTISSYLWKMLAEAGFPTVLVDVDLRKSVMKTR
                                             GKS                 VLVDVDLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FQMDYDDDTTMGLNHYLSGMAEYEDVVYSTNIPNGYMVPCTQLLENPSALLEDVRFKELLNTLSENYRFVIIDSPPLGSV
FQMDYDDDTTMGLNHYLSGMAEYEDVVYSTNIPNGYMVPCTQLLENPSALLEDVRFKELLNTLSENYRFVIIDSPPLGSV
                                                                     VIIDSPP    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADGALIASLCDGAVLVVRAGTTPRTLIKQSLYEIQQSGCKLLGTVLNRADVKGRAYGKYGYGKYGYGYGYGYGYGYEPKD
ADGALIASLCDGAVLVVRAGTTPRTLIKQSLYEIQQSGCKLLGTVLNRADVKGRAYGKYGYGKYGYGYGYGY        
                                                       YGKYGYGKYGYGYGYGYGYGY    
       250       
....:....|....:..
KKNSSDSAATDKNSTGN


© 1998-2019