BYKdb

Annotate results for A0A1C6H3C6

A0A1C6H3C6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6H3C6
DOMAINcd57/240TSYSKGEGKSTVSANLAISFSKMEKRVLLIDCDLRRPNVHNFFKLDNKKGLTNVIGKMIE
IDEAVKHDVLPNLDILPAGTVAPNPSELMCSTRFQELYEQFVRDYDYVIFDTPPIGVVAD
ALLLKDMIAGFVVVVRERSTTHGDLQHLLDSVKLADSTVLGLIEVGCTYDSKRRKKGYYY
YQYY
SITEWalker A64/66GKS
SITEWalker A'84/91LLIDCDLR
SITEWalker B164/170VIFDTPP
SITE-161/-163YDY
SITEY Cluster234/240YYYYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASDFKLFKKKDDKKNNGQNFSLSDKSKFAIVESYKAARTNIMFSLSAKEKKCFAVTSYSKGEGKSTVSANLAISFSKME
                                                        TSYSKGEGKSTVSANLAISFSKME
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRVLLIDCDLRRPNVHNFFKLDNKKGLTNVIGKMIEIDEAVKHDVLPNLDILPAGTVAPNPSELMCSTRFQELYEQFVRD
KRVLLIDCDLRRPNVHNFFKLDNKKGLTNVIGKMIEIDEAVKHDVLPNLDILPAGTVAPNPSELMCSTRFQELYEQFVRD
   LLIDCDLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDYVIFDTPPIGVVADALLLKDMIAGFVVVVRERSTTHGDLQHLLDSVKLADSTVLGLIEVGCTYDSKRRKKGYYYYQYY
YDYVIFDTPPIGVVADALLLKDMIAGFVVVVRERSTTHGDLQHLLDSVKLADSTVLGLIEVGCTYDSKRRKKGYYYYQYY
   VIFDTPP                                                               YYYYQYY
© 1998-2019