BYKdb

Annotate results for A0A1C6HQH6

A0A1C6HQH6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6HQH6
DOMAINcd41/231TSAVPNEGKSEISFSLASSLAQIDNRVLLIDADVRKSVLVTRYKLDRKIEGLSQYLSGQK
KLEEVIYTTNIPNLDVIFSGPLSPNPAELLEEPLFKKLIDHAREEYAYVIIDTPPMSTII
DGAIVAGHCDGAIMVVESGGVSYRVLQKVKRQLERSGCRILGTVLNRVNMQVQGYYRYYG
KYGRYHYVYGY
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDADVR
SITEWalker B149/155VIIDTPP
SITE-146/-148YAY
SITEY Cluster215/233YYRYYGKYGRYHYVYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGKEISLMRDQKEDYQYEEAIKTLRTNIQFSGTNLQVIMLTSAVPNEGKSEISFSLASSLAQIDNRVLLIDADVRKSVLV
                                        TSAVPNEGKSEISFSLASSLAQIDNRVLLIDADVRKSVLV
                                               GKS                 LLIDADVR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRYKLDRKIEGLSQYLSGQKKLEEVIYTTNIPNLDVIFSGPLSPNPAELLEEPLFKKLIDHAREEYAYVIIDTPPMSTII
TRYKLDRKIEGLSQYLSGQKKLEEVIYTTNIPNLDVIFSGPLSPNPAELLEEPLFKKLIDHAREEYAYVIIDTPPMSTII
                                                                    VIIDTPP     
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
DGAIVAGHCDGAIMVVESGGVSYRVLQKVKRQLERSGCRILGTVLNRVNMQVQGYYRYYGKYGRYHYVYGYGYGRENKK
DGAIVAGHCDGAIMVVESGGVSYRVLQKVKRQLERSGCRILGTVLNRVNMQVQGYYRYYGKYGRYHYVYGY        
                                                      YYRYYGKYGRYHYVYGYGY      
© 1998-2019