BYKdb

Annotate results for A0A1C6I684

A0A1C6I684 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6I684
DOMAINcd40/231TSTIPNEGKSSVSFNLAASIAESGKKVIFIDADLRKSVLVGRYKINKAVKGFTHYLSGVN
AFDEVVYSTNVENLHVVFSGPVPPNPAELLGNKYFKTLIKQLRQTYDYVIIDTPPIGSVI
DAAIIAQECDGVVMVVAAGEISYKLVQKTKAQLEKADCKILGVVLNKVPTGKGGYYGKYY
GHYGHYGEYGNY
SITEWalker A47/49GKS
SITEWalker A'67/74IFIDADLR
SITEWalker B148/154VIIDTPP
SITE-145/-147YDY
SITEY Cluster214/237YYGKYYGHYGHYGEYGNYGNYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLNINIDKLKKLDNSSNEAYKRLRTNVQFCGSDVKVIALTSTIPNEGKSSVSFNLAASIAESGKKVIFIDADLRKSVLVG
                                       TSTIPNEGKSSVSFNLAASIAESGKKVIFIDADLRKSVLVG
                                              GKS                 IFIDADLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYKINKAVKGFTHYLSGVNAFDEVVYSTNVENLHVVFSGPVPPNPAELLGNKYFKTLIKQLRQTYDYVIIDTPPIGSVID
RYKINKAVKGFTHYLSGVNAFDEVVYSTNVENLHVVFSGPVPPNPAELLGNKYFKTLIKQLRQTYDYVIIDTPPIGSVID
                                                                   VIIDTPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAIIAQECDGVVMVVAAGEISYKLVQKTKAQLEKADCKILGVVLNKVPTGKGGYYGKYYGHYGHYGEYGNYGNYGNYGQS
AAIIAQECDGVVMVVAAGEISYKLVQKTKAQLEKADCKILGVVLNKVPTGKGGYYGKYYGHYGHYGEYGNY         
                                                     YYGKYYGHYGHYGEYGNYGNYGNY   
   
...
AKK


© 1998-2019