BYKdb

Annotate results for A0A1C6IDE5

A0A1C6IDE5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6IDE5
DOMAINcd286/478SSTVPGEGKTTVAVNLALTLGQNGARVILVDMDLRKPSVKKALGLTAPSKGVPELLRSGE
ESPKAALMELEGTRVRVLAGDKAVENPRRQLESRKLSGLIKALREEADYVVIDTPPNGLL
GDSTALAGLADGILYVVRAGKAQVPHIMDSIQLLSSSRTPLMGCVLNGVKENGGGYGYGY
GYGYGGYRGYERH
SITEWalker A293/295GKT
SITEWalker A'313/320ILVDMDLR
SITEWalker B395/401VVIDTPP
SITEY Cluster461/475YGYGYGYGYGGYRGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDEQKTKQHTEAPEPIDLTALLGELWRIFTRMFWVPLVLAVLAGGLLGLRSWRSYTPMYRSEATFTVQLLSNQYDITGVD


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SYYDKAAAEQLANTFPYLLSSDLMQQLLQRELGVGWLNGSITAQSVANTNLFSVQVTSTSAQDACDILNGVIAVYPQVAN


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVVGSTELTVLVPPAVASQPYNAFQPTRTIIKGAVLGFGVGVVFLLVLAMASKTIRTREDMKKWMNVPCLGTLPTVSFKR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RTGKTGGTVTILNDRTGSAFQESIRSLRIRFLREAERQESKVFLVSSTVPGEGKTTVAVNLALTLGQNGARVILVDMDLR
                                             SSTVPGEGKTTVAVNLALTLGQNGARVILVDMDLR
                                                    GKT                 ILVDMDLR
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPSVKKALGLTAPSKGVPELLRSGEESPKAALMELEGTRVRVLAGDKAVENPRRQLESRKLSGLIKALREEADYVVIDTP
KPSVKKALGLTAPSKGVPELLRSGEESPKAALMELEGTRVRVLAGDKAVENPRRQLESRKLSGLIKALREEADYVVIDTP
                                                                          VVIDTP
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNGLLGDSTALAGLADGILYVVRAGKAQVPHIMDSIQLLSSSRTPLMGCVLNGVKENGGGYGYGYGYGYGGYRGYERHSR
PNGLLGDSTALAGLADGILYVVRAGKAQVPHIMDSIQLLSSSRTPLMGCVLNGVKENGGGYGYGYGYGYGGYRGYERH  
P                                                           YGYGYGYGYGGYRGY     
       490   
....:....|...
KSGRDGQLEEERK


© 1998-2019