BYKdb

Annotate results for A0A1C6IHE6

A0A1C6IHE6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6IHE6
DOMAINcd282/471SSTLPGEGKTTVAVNLALTLSQNGARVILVDLDLRKPSVKRCLGVSVPSRGAPELLNLRG
ADPREHLLTLEGTQVRLLAGDEPSSNPRRQMESRRLEALLTTLREEADYVILDTPPCGLL
GDGAALAGLADASLYVVRSGTAQVSHILDSLQFLAGSGTPLMGCVLNGASGGGGRYGYGY
GYGYGGDHYG
SITEWalker A289/291GKT
SITEWalker A'309/316ILVDLDLR
SITEWalker B391/397VILDTPP
SITEY Cluster457/476YGYGYGYGYGGDHYGKYHAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEEHKLDQEEGRIDLYRLLPELGRALRRLFWVPLLLALLGAAAMGVRAWRSYVPLYHSEATFTIETSASALSDMAGSGSY


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDKATAEQLAKTFPYLLQSDLLQSLLRQELGVSWLNGSISARAVDNTSLFSLRVTSTSAQDAYDILETVIRIYPRVADYV


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VGSTEMHILTQPAVAAQPDAPFDPVRSICKGALLGLALGLAVVLLFAATRRTVRTPEEVKRRLNQTCLASLPAVRFKRRS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQFDRTISIQNPRISGAFLENVRSLRIKFLRAAEGRKVIMVSSTLPGEGKTTVAVNLALTLSQNGARVILVDLDLRKPSV
                                         SSTLPGEGKTTVAVNLALTLSQNGARVILVDLDLRKPSV
                                                GKT                 ILVDLDLR    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRCLGVSVPSRGAPELLNLRGADPREHLLTLEGTQVRLLAGDEPSSNPRRQMESRRLEALLTTLREEADYVILDTPPCGL
KRCLGVSVPSRGAPELLNLRGADPREHLLTLEGTQVRLLAGDEPSSNPRRQMESRRLEALLTTLREEADYVILDTPPCGL
                                                                      VILDTPP   
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGDGAALAGLADASLYVVRSGTAQVSHILDSLQFLAGSGTPLMGCVLNGASGGGGRYGYGYGYGYGGDHYGKYHAYRQEK
LGDGAALAGLADASLYVVRSGTAQVSHILDSLQFLAGSGTPLMGCVLNGASGGGGRYGYGYGYGYGGDHYG         
                                                        YGYGYGYGYGGDHYGKYHAY    
© 1998-2019