BYKdb

Annotate results for A0A1C6ITD7

A0A1C6ITD7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1C6ITD7
DOMAINtad1/141MKNILYYLDIIKKHLTLIIIITLISTILTAITTIFFIEPTYQANISIIIGQNQSTVDEGT
SYPGSYDVVMYQKMVKTYSEMITSRVVLEDVIENTGLDLNLADLESMIKIRTTTESEFIS
ISIEGKIAKDTATIANQLVLS
DOMAINcd270/448TSSSPSEGKSTIISNLGISIALTNKKVVIIDCDMRKPRIHRLFSLSNIIGLSHILSNQAE
LEECLQSSGIENLSILTAGVIPPNPSELISSNGMKMLLDRLSSNFDFILIDSPPLPLVAD
SQVLSTFVDGTIIVTKFGYTTKSALINTKEILDGLNTNVIGVLLNNSPINSSSNYYYKE
SITEWalker A277/279GKS
SITEWalker A'297/304VIIDCDMR
SITEWalker B377/383ILIDSPP
SITEY Cluster444/446YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKNILYYLDIIKKHLTLIIIITLISTILTAITTIFFIEPTYQANISIIIGQNQSTVDEGTSYPGSYDVVMYQKMVKTYSE
MKNILYYLDIIKKHLTLIIIITLISTILTAITTIFFIEPTYQANISIIIGQNQSTVDEGTSYPGSYDVVMYQKMVKTYSE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MITSRVVLEDVIENTGLDLNLADLESMIKIRTTTESEFISISIEGKIAKDTATIANQLVLSLKNISSELRGVDNVIMVDT
MITSRVVLEDVIENTGLDLNLADLESMIKIRTTTESEFISISIEGKIAKDTATIANQLVLS                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASIPEKPSKPNIILNIGLSFLLGLMLSICLVILIDYLDQRIKDKSELKELIHLPILGEIPNFSSININNEDNYLFANVSP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSLPSEAINILRTNLQFCNVNSNLKKILITSSSPSEGKSTIISNLGISIALTNKKVVIIDCDMRKPRIHRLFSLSNIIGL
                             TSSSPSEGKSTIISNLGISIALTNKKVVIIDCDMRKPRIHRLFSLSNIIGL
                                    GKS                 VIIDCDMR                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SHILSNQAELEECLQSSGIENLSILTAGVIPPNPSELISSNGMKMLLDRLSSNFDFILIDSPPLPLVADSQVLSTFVDGT
SHILSNQAELEECLQSSGIENLSILTAGVIPPNPSELISSNGMKMLLDRLSSNFDFILIDSPPLPLVADSQVLSTFVDGT
                                                        ILIDSPP                 
       410       420       430       440        
....:....|....:....|....:....|....:....|....:...
IIVTKFGYTTKSALINTKEILDGLNTNVIGVLLNNSPINSSSNYYYKE
IIVTKFGYTTKSALINTKEILDGLNTNVIGVLLNNSPINSSSNYYYKE
                                           YYY  
© 1998-2019