BYKdb

Annotate results for A0A1C6JJM7

A0A1C6JJM7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6JJM7
DOMAINcd270/468SSLKENDGKSTAAANLVLNLVQRGKKVVLVDCDMRRSAVCKIFDIDMKDQKQLYDYLTEE
STLQDVLIEYGQDERKFFCILQKKAVSEPEKWFDSERFEHMLKELSGSFDYVILDTAPIG
IVRDAEIIAGYADSVFMVMKQDEVHAASVNDVIDILEDAGSVVVGGVLNMARGEKIAGNG
YHKYKYGSYYYGYAYGKDG
SITEWalker A277/279GKS
SITEWalker A'297/304VLVDCDMR
SITEWalker B381/387VILDTAP
SITE-323/-325YDY
SITEY Cluster450/464YHKYKYGSYYYGYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQEHYKNQNVQSYDVKYISRCLMRNALFILMFACLAGVFSYIFLDHYKKDTYTASVNLYVIPRDNAGTKFNSNGISSAV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRCVSALNSDMMKEQIKKEKDADKLKGNLSAYAAGSTNIIVMSATSSSAESACRLLKAGIDNYPKLSGYFQTGYLLKKIG


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFEGNGITVNHADAPISALKVALLVLIAGCGLVGAMAVFTDKVHSVEQAQKLLDMDVFGALPFVKKKQEQKSILITDPRT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSQYAEAVDKIVTKLRRKMHENHYKVLMVSSLKENDGKSTAAANLVLNLVQRGKKVVLVDCDMRRSAVCKIFDIDMKDQK
                             SSLKENDGKSTAAANLVLNLVQRGKKVVLVDCDMRRSAVCKIFDIDMKDQK
                                    GKS                 VLVDCDMR                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLYDYLTEESTLQDVLIEYGQDERKFFCILQKKAVSEPEKWFDSERFEHMLKELSGSFDYVILDTAPIGIVRDAEIIAGY
QLYDYLTEESTLQDVLIEYGQDERKFFCILQKKAVSEPEKWFDSERFEHMLKELSGSFDYVILDTAPIGIVRDAEIIAGY
                                                            VILDTAP             
       410       420       430       440       450       460       470   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
ADSVFMVMKQDEVHAASVNDVIDILEDAGSVVVGGVLNMARGEKIAGNGYHKYKYGSYYYGYAYGKDGQHAGK
ADSVFMVMKQDEVHAASVNDVIDILEDAGSVVVGGVLNMARGEKIAGNGYHKYKYGSYYYGYAYGKDG     
                                                 YHKYKYGSYYYGYAY         
© 1998-2019