BYKdb

Annotate results for A0A1C6JJP6

A0A1C6JJP6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6JJP6
DOMAINcd289/475SSTLPQEGKSMTAVNLALAFMQHEKKTVLIDGDLRKPSVAEMLGMEEQKGLAEYLKGNAK
VKEVLQKKGDLTVIQGGKVHGNISSLMDESRMEELMTFLKSEFDYVIIDTPPAYLFSDAA
ILAGYADRVLYVVRHDMAEIPQIEKGMESFIQEDKLLGYLINRSQKGFASYGKYGYGKYG
YGKYGKY
SITEWalker A296/298GKS
SITEWalker A'316/323VLIDGDLR
SITEWalker B394/400VIIDTPP
SITE-413/-419YADRVLY
SITEY Cluster459/478YGKYGYGKYGYGKYGKYQRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQESDKVRAERVRTGQQYGAGQEGIDLFNMMDDALRCFQKYWLQFLLLIVIVTAVFIIYGNRQYVPQYQAKVTYAVNKTG


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSDTDASIAQRLSNSISVVTKTGDFKDRLFADVEEENVNPNYVISSAYTDNSNLFSVTVTANNYNNANMLLDLLENMYPE


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WVAGSNGTIELQVVDRVLAGENPVNGYSAIKQLVEGVLAGVILCLAIAALYAQLIRTVRKESDMKKITSKGCISLIPEIA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKKREKSKKQQLLLTNKRVDWGFKQSVQAAQLRIEKQMEQEHKQVLLVSSTLPQEGKSMTAVNLALAFMQHEKKTVLIDG
                                                SSTLPQEGKSMTAVNLALAFMQHEKKTVLIDG
                                                       GKS                 VLIDG
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRKPSVAEMLGMEEQKGLAEYLKGNAKVKEVLQKKGDLTVIQGGKVHGNISSLMDESRMEELMTFLKSEFDYVIIDTPP
DLRKPSVAEMLGMEEQKGLAEYLKGNAKVKEVLQKKGDLTVIQGGKVHGNISSLMDESRMEELMTFLKSEFDYVIIDTPP
DLR                                                                      VIIDTPP
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYLFSDAAILAGYADRVLYVVRHDMAEIPQIEKGMESFIQEDKLLGYLINRSQKGFASYGKYGYGKYGYGKYGKYQRYVD
AYLFSDAAILAGYADRVLYVVRHDMAEIPQIEKGMESFIQEDKLLGYLINRSQKGFASYGKYGYGKYGYGKYGKY     
                                                          YGKYGYGKYGYGKYGKYQRY  
       490  
....:....|..
VKEDDMDTEDSL


© 1998-2019