BYKdb

Annotate results for A0A1C6K495

A0A1C6K495 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6K495
DOMAINcd38/215TSANPREGKSTTASNLALTLAEGEEKVLLIDCDMRKPSIHKNFKVTNNYGISEILVQNKK
VMDIANKYNNNLHIITIGKIPPNTFEMLASKTMTLFLEEMKEHFDYVILDTPPFQAVADP
QILYTKVDGTLVLVRSGKTKKDDVNNSISLLKKVNADIIGTVLHAVDKSNNKYYYYYG
SITE-174/-176GKT
SITEWalker A'65/72LLIDCDMR
SITEWalker B144/150VILDTPP
SITEY Cluster210/214YYYYY
SITEWalker A45/47GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFVVEKNPKSVAAEAYRTLNTNIHYSSVDKKYKSIAVTSANPREGKSTTASNLALTLAEGEEKVLLIDCDMRKPSIHKNF
                                     TSANPREGKSTTASNLALTLAEGEEKVLLIDCDMRKPSIHKNF
                                            GKS                 LLIDCDMR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVTNNYGISEILVQNKKVMDIANKYNNNLHIITIGKIPPNTFEMLASKTMTLFLEEMKEHFDYVILDTPPFQAVADPQIL
KVTNNYGISEILVQNKKVMDIANKYNNNLHIITIGKIPPNTFEMLASKTMTLFLEEMKEHFDYVILDTPPFQAVADPQIL
                                                               VILDTPP          
       170       180       190       200       210     
....:....|....:....|....:....|....:....|....:....|....:
YTKVDGTLVLVRSGKTKKDDVNNSISLLKKVNADIIGTVLHAVDKSNNKYYYYYG
YTKVDGTLVLVRSGKTKKDDVNNSISLLKKVNADIIGTVLHAVDKSNNKYYYYYG
                                                 YYYYY 
© 1998-2019