BYKdb

Annotate results for A0A1C6K796

A0A1C6K796 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6K796
DOMAINcd38/217TSSNPGEGKSTTAGNLALTLAEGEAKVLLVDCDMRKPSVHKNFRITNTYGISDILLQKKK
VTEVAYSYNKNLSIITAGKVPPNPSEMLASKAMTAFLKEMKDHFDYIVLDTPPVQAVADA
QILSTKTDGTLVVVRAGVTKKDEVKNTINTLNKINANIIGTILHAVDNTRNKYQYYYENE
SITEWalker A45/47GKS
SITEWalker A'65/72LLVDCDMR
SITEWalker B144/150IVLDTPP
SITE-103/-105YSY
SITEY Cluster210/214YQYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFIVEKSPKSVAAEAYRALKTNIQYSSFDKEYKTIVITSSNPGEGKSTTAGNLALTLAEGEAKVLLVDCDMRKPSVHKNF
                                     TSSNPGEGKSTTAGNLALTLAEGEAKVLLVDCDMRKPSVHKNF
                                            GKS                 LLVDCDMR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RITNTYGISDILLQKKKVTEVAYSYNKNLSIITAGKVPPNPSEMLASKAMTAFLKEMKDHFDYIVLDTPPVQAVADAQIL
RITNTYGISDILLQKKKVTEVAYSYNKNLSIITAGKVPPNPSEMLASKAMTAFLKEMKDHFDYIVLDTPPVQAVADAQIL
                                                               IVLDTPP          
       170       180       190       200       210       
....:....|....:....|....:....|....:....|....:....|....:..
STKTDGTLVVVRAGVTKKDEVKNTINTLNKINANIIGTILHAVDNTRNKYQYYYENE
STKTDGTLVVVRAGVTKKDEVKNTINTLNKINANIIGTILHAVDNTRNKYQYYYENE
                                                 YQYYY   
© 1998-2019