BYKdb

Annotate results for A0A1C6K9V6

A0A1C6K9V6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6K9V6
DOMAINcd38/224TSSIMGEGKSTVAGNLANILSQDGARVLIIDCDLRKPSVHYNFFVTNGEGLTDVLVGNSD
LKSVIKKVDDSLFLITAGTVPPNPSEILGSHGMENLLEDLAVNFDYIILDTPPVLPVTDA
LLLSAKADGTLIVVKSRVTKEKMVKETYDKLIDVRANVIGTVLNACDKSIDNKYYGYYGD
FKKSKNK
SITEWalker A45/47GKS
SITEWalker A'65/72LIIDCDLR
SITEWalker B144/150IILDTPP
SITEY Cluster211/215YYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFITKKMPKSLSAEAYRSLRTSIKFSSVDRPIKTLVVTSSIMGEGKSTVAGNLANILSQDGARVLIIDCDLRKPSVHYNF
                                     TSSIMGEGKSTVAGNLANILSQDGARVLIIDCDLRKPSVHYNF
                                            GKS                 LIIDCDLR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FVTNGEGLTDVLVGNSDLKSVIKKVDDSLFLITAGTVPPNPSEILGSHGMENLLEDLAVNFDYIILDTPPVLPVTDALLL
FVTNGEGLTDVLVGNSDLKSVIKKVDDSLFLITAGTVPPNPSEILGSHGMENLLEDLAVNFDYIILDTPPVLPVTDALLL
                                                               IILDTPP          
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
SAKADGTLIVVKSRVTKEKMVKETYDKLIDVRANVIGTVLNACDKSIDNKYYGYYGDFKKSKNKKFKIK
SAKADGTLIVVKSRVTKEKMVKETYDKLIDVRANVIGTVLNACDKSIDNKYYGYYGDFKKSKNK     
                                                  YYGYY              
© 1998-2019