BYKdb

Annotate results for A0A1C6KRD9

A0A1C6KRD9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6KRD9
DOMAINcd39/232TSCQPNEGKSTISSYLWKMLAEAGFPTVLVDVDLRKSVMKTRFQMDYDDDTTMGLNHYLS
GMAEYEDVIYSTNIPNGYMVPCTQLLENPSALLEDVRFKELLNTLSENYRFVIIDSPPLG
SVSDGALIASLCDGAVLVVRAGTTPRTLIKQSLYEIQQSGCKLLGTVLNRADVKGRAYGK
YGYGKYGYGYGYGY
SITEWalker A46/48GKS
SITEWalker A'66/73VLVDVDLR
SITEWalker B150/156VIIDSPP
SITE-103/-108YEDVIY
SITEY Cluster216/234YGKYGYGKYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQLNVNLPELPYAVSEAMNRLRINIKFCGKNTRKILLTSCQPNEGKSTISSYLWKMLAEAGFPTVLVDVDLRKSVMKTR
                                      TSCQPNEGKSTISSYLWKMLAEAGFPTVLVDVDLRKSVMKTR
                                             GKS                 VLVDVDLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FQMDYDDDTTMGLNHYLSGMAEYEDVIYSTNIPNGYMVPCTQLLENPSALLEDVRFKELLNTLSENYRFVIIDSPPLGSV
FQMDYDDDTTMGLNHYLSGMAEYEDVIYSTNIPNGYMVPCTQLLENPSALLEDVRFKELLNTLSENYRFVIIDSPPLGSV
                                                                     VIIDSPP    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDGALIASLCDGAVLVVRAGTTPRTLIKQSLYEIQQSGCKLLGTVLNRADVKGRAYGKYGYGKYGYGYGYGYGYEPKDKK
SDGALIASLCDGAVLVVRAGTTPRTLIKQSLYEIQQSGCKLLGTVLNRADVKGRAYGKYGYGKYGYGYGYGY        
                                                       YGKYGYGKYGYGYGYGYGY      
       250     
....:....|....:
NSSDSAAADKNSTGK


© 1998-2019