BYKdb

Annotate results for A0A1C6KSE6

A0A1C6KSE6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1C6KSE6
DOMAINcd43/233TSCTENEGKSTTALNLSFSFTEDGKKVLLIDADLRKSVFIGANKLRADGQIMGLSHYLSG
QCMMEDVIYQTDVKGLDLVVAGPTAPNPTELLGGERFENLIRKARETYDIVLIDSPPLGM
VIDTVVMAHCCDGAIIVIESDMISYRYALEVKKQLEFADCRILGTVLNKVDLGGGKYYKG
YYKKGKYGAYK
SITEWalker A50/52GKS
SITEWalker A'70/77LLIDADLR
SITEWalker B153/159VLIDSPP
SITE-187/-189YRY
SITEY Cluster219/232YYKGYYKKGKYGAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLKKTAKFGKPQETDYATKEAFNSLRTNLKFCGDDIRVVALTSCTENEGKSTTALNLSFSFTEDGKKVLLIDADLRKSV
                                          TSCTENEGKSTTALNLSFSFTEDGKKVLLIDADLRKSV
                                                 GKS                 LLIDADLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FIGANKLRADGQIMGLSHYLSGQCMMEDVIYQTDVKGLDLVVAGPTAPNPTELLGGERFENLIRKARETYDIVLIDSPPL
FIGANKLRADGQIMGLSHYLSGQCMMEDVIYQTDVKGLDLVVAGPTAPNPTELLGGERFENLIRKARETYDIVLIDSPPL
                                                                        VLIDSPP 
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
GMVIDTVVMAHCCDGAIIVIESDMISYRYALEVKKQLEFADCRILGTVLNKVDLGGGKYYKGYYKKGKYGAYK
GMVIDTVVMAHCCDGAIIVIESDMISYRYALEVKKQLEFADCRILGTVLNKVDLGGGKYYKGYYKKGKYGAYK
                                                          YYKGYYKKGKYGAY 
© 1998-2019